PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 532aa    MW: 58631.6 Da    PI: 6.4249
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012904genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.65.4e-28251308260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  +DgynWrKYGqK v+g++f rsYY+Ct+ +Cp+kk+ver++ ++++++i  +g+H+h+k
  DCAR_012904 251 EDGYNWRKYGQKLVRGNQFVRSYYKCTFLSCPAKKQVERTH-EGNITNINCRGNHEHPK 308
                  7***************************************9.***************85 PP

2WRKY102.72.1e-32424482159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ++Dgy+WrKYGqK vkg+ +prsYYrC+ +gCpvkk+ver+++d kvv++tYeg+H+h+
  DCAR_012904 424 VNDGYRWRKYGQKLVKGNANPRSYYRCSNTGCPVKKHVERASHDSKVVITTYEGQHDHT 482
                  58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-24245309IPR003657WRKY domain
SuperFamilySSF1182908.11E-22248309IPR003657WRKY domain
SMARTSM007742.2E-27250308IPR003657WRKY domain
PfamPF031063.6E-21251307IPR003657WRKY domain
PROSITE profilePS5081120.082251309IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-33412484IPR003657WRKY domain
SuperFamilySSF1182909.15E-28419484IPR003657WRKY domain
PROSITE profilePS5081133.706419484IPR003657WRKY domain
SMARTSM007743.7E-37424483IPR003657WRKY domain
PfamPF031061.7E-25425481IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MLKAHVVTSR EGMPDAISVD KYQQGENPDA VFHDSVSNQK EIPPSGVHDK EEQGNLQQRQ  60
KPSEAGASQV SQEVSIGRVE SEKLPNNLKP VQSLDDITDA SQSNQDGSSI SMVHETEPVS  120
LHQGHSYDSA IRTSESCQEG SSLSTIPELE LDNSLPTQSL GTIILTSKTA EHGTALSTVP  180
ENVQDTLQQN QDPDTCLSVS KSDQEKSSLS IMQEKVLEKL PLRRNPDIGV QPLQSVQEGS  240
PRSKLPEKPS EDGYNWRKYG QKLVRGNQFV RSYYKCTFLS CPAKKQVERT HEGNITNINC  300
RGNHEHPKPQ QSPQTPVPLQ AKRPEKSPVT RSEDETTDVH KEIPHQIVLI ETPKPLRVQA  360
SVDVMESSAS KSNKTKDRVD QDADPESKRR KRDNSTSDDV LSSANRTNGG TRIVIQSTSL  420
VDIVNDGYRW RKYGQKLVKG NANPRSYYRC SNTGCPVKKH VERASHDSKV VITTYEGQHD  480
HTMPSARTVT HNTSGADTNA NPQNGEARSD TEEKETPTSG LEMVVHVGAS E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-35252484174WRKY transcription factor 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45582242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-75zinc-dependent activator protein-1